PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02110.1.p
Common NameEUGRSUZ_A02110, LOC104443016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 313aa    MW: 34900.8 Da    PI: 7.3062
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-172976148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEde l+ +v++ G g+W+t +++ g+ R++k+c++rw +yl
  Eucgr.A02110.1.p 29 RGPWTPEEDEVLASYVRREGEGRWRTLPKRAGLQRCGKSCRLRWMNYL 76
                      89********************************************97 PP

2Myb_DNA-binding475.8e-1587127648
                       HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.A02110.1.p  87 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 127
                       89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-232078IPR009057Homeodomain-like
PROSITE profilePS5129416.7822476IPR017930Myb domain
SuperFamilySSF466894.77E-2926123IPR009057Homeodomain-like
SMARTSM007171.5E-112878IPR001005SANT/Myb domain
PfamPF002492.8E-152976IPR001005SANT/Myb domain
CDDcd001673.50E-103176No hitNo description
PROSITE profilePS5129424.39777131IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2479132IPR009057Homeodomain-like
SMARTSM007172.7E-1381129IPR001005SANT/Myb domain
CDDcd001671.02E-1187127No hitNo description
PfamPF002499.5E-1487127IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MRYPAPAPAS RGKSTSTATP CCSKVGIKRG PWTPEEDEVL ASYVRREGEG RWRTLPKRAG  60
LQRCGKSCRL RWMNYLRPSV KRGQIAPDEE DLILRLHRLL GNRWSLIAGR IPGRTDNEIK  120
NYWNTHLSKK LISQGIDPRT HKPLLNHNPS SSLAAHLQDT YNASTFTPKA TYPNPTVPVE  180
ETGDENDLKV ADSQLGQPQN AGVAQDHNNE NWQNVEGLTM MNSFGQNYAD HNCNNEDIFS  240
SFLDSLVEDE YTNQYHRGLT AAVPAQFAPG VSFTSAPSFN HGNVTWELPG LRPEVESLGD  300
QQNAVLYNNH LP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25291317108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02110.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054687.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388503e-81MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A059DGK70.0A0A059DGK7_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g07230.t012e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-82myb domain protein 5